Primary Antibodies

Jump to Filters
View as table Download
GNG3 Rabbit Polyclonal Antibody
TA331327

USD 375.00

5 Days

Rabbit Polyclonal Anti-GNG3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GNG3 antibody is: synthetic peptide directed towards the middle region of Human GNG3. Synthetic peptide located within the following region: IEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPTSENPFREKKFFCAL
GNG3 Rabbit Polyclonal Antibody
TA368411

USD 380.00

4 Weeks

GNG3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GNG3