Primary Antibodies

Jump to Filters
View as table Download
Kv4.2 (KCND2) Rabbit Polyclonal Antibody
TA338567

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCND2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCND2 antibody: synthetic peptide directed towards the middle region of human KCND2. Synthetic peptide located within the following region: RIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHHL
Kv4.2 (KCND2) Rabbit Polyclonal Antibody
TA377702

USD 220.00

3 Weeks

KCND2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 501-630 of human KCND2 (NP_036413.1).
Modifications Unmodified