Rabbit Polyclonal Anti-OR5M10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR5M10 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR5M10. Synthetic peptide located within the following region: SAEGRHKAFSTCASHLTIVTLFYGTLFCMYVRPPSEKSVEESKIIAVFYT |
Rabbit Polyclonal Anti-OR5M10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR5M10 antibody is: synthetic peptide directed towards the middle region of Human OR5M10. Synthetic peptide located within the following region: NGLSQTLLTFHLSFCGSLEINHFYCADPPLIMLACSDTRVKKMAMFVVAG |
Germany
Japan
United Kingdom
China