Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-PRDM9 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRDM9 antibody: synthetic peptide directed towards the middle region of human PRDM9. Synthetic peptide located within the following region: CPGDQNQEQQYPDPHSRNDKTKGQEIKERSKLLNKRTWQREISRAFSSPP

PRDM9 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRDM9.
Modifications Unmodified

Recombinant Anti-PRDM9 (Clone RAB-C370)

Applications ChIP, ELISA, IF
Reactivities Human
Conjugation His Tag

Recombinant Anti-PRDM9 (Clone RAB-C370)

Applications ChIP, ELISA, IF
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Human Fab format, for improved compatibility with existing reagents, assays and techniques.