Germany
Japan
United Kingdom
China
Rabbit anti-SUV39H2 Polyclonal Antibody
| Applications | ChIP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SUV39H2 |
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-SUV39H2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SUV39H2 antibody: synthetic peptide directed towards the middle region of human SUV39H2. Synthetic peptide located within the following region: LDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRT |
Rabbit polyclonal anti-SUV39H2 antibody
| Applications | WB |
| Reactivities | Human Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SUV39H2. |
SUV39H2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SUV39H2 |
SUV39H2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SUV39H2 |
Active filters
Target Symbol
- SUV39H2
Reactivities
- Human