Primary Antibodies

View as table Download

Goat Polyclonal Anti-creatine kinase M-type (aa258-270) Antibody

Applications WB
Reactivities Human, Mouse, Pig (Expected from sequence similarity: Rat, Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-creatine kinase M-type (aa258-270) Antibody: Peptide with sequence C-QKIEEIFKKAGHP, from the internal region of the protein sequence according to NP_001815.2.

Rabbit polyclonal anti-CKM / M-CK antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human M-CK.

Rabbit Polyclonal Anti-CKM Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CKM antibody: synthetic peptide directed towards the N terminal of human CKM. Synthetic peptide located within the following region: VGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDL

Rabbit Polyclonal Anti-CKM Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CKM antibody: synthetic peptide directed towards the middle region of human CKM. Synthetic peptide located within the following region: GVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSI

Anti-CKM Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 14-26 amino acids of Human creatine kinase, muscle

CKM Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-381 of human CKM (NP_001815.2).
Modifications Unmodified