Goat Anti-DMRT2 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KRPSSAITRVSQ, from the C Terminus of the protein sequence according to NP_006548.1; NP_870987.2. |
Goat Anti-DMRT2 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KRPSSAITRVSQ, from the C Terminus of the protein sequence according to NP_006548.1; NP_870987.2. |
Rabbit polyclonal anti-DMRT2 antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DMRT2 antibody: synthetic peptide directed towards the C terminal of mouse DMRT2. Synthetic peptide located within the following region: RPSLPLKTNPFHSVFQQTLSDKSGPELNAPFVKEAFEETPKKHRECLVKE |