Primary Antibodies

View as table Download

Goat Anti-DMRT2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KRPSSAITRVSQ, from the C Terminus of the protein sequence according to NP_006548.1; NP_870987.2.

Rabbit polyclonal anti-DMRT2 antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DMRT2 antibody: synthetic peptide directed towards the C terminal of mouse DMRT2. Synthetic peptide located within the following region: RPSLPLKTNPFHSVFQQTLSDKSGPELNAPFVKEAFEETPKKHRECLVKE