Primary Antibodies

Jump to Filters
View as table Download
Hmgcs1 Rabbit Polyclonal Antibody
TA346706

USD 475.00

5 Days

Rabbit Polyclonal Anti-Hmgcs1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Hmgcs1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hmgcs1. Synthetic peptide located within the following region: LVRVDEKHRRTYARRPFTNDHSLDEGMGLVHSNTATEHIPSPAKKVPRLP
HMGCS1 Rabbit Polyclonal Antibody
TA377141

USD 220.00

3 Weeks

HMGCS1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 241-520 of human HMGCS1 (NP_002121.4).
Modifications Unmodified