Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-REN Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-REN antibody: synthetic peptide directed towards the C terminal of human REN. Synthetic peptide located within the following region: YSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALA

REN Rabbit Polyclonal Antibody

Applications WB
Reactivities Human Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human REN