Anti-UAP1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 290 amino acids of human UDP-N-acteylglucosamine pyrophosphorylase 1 |
Anti-UAP1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 290 amino acids of human UDP-N-acteylglucosamine pyrophosphorylase 1 |
Rabbit polyclonal Anti-Uap1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Uap1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LKDANDVPIQCEISPLISYAGEGLEGYVADKEFHAPLIIDENGVHELVKN |