Primary Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 35 of 35 results

(reset)

Cpa2 Rabbit Polyclonal Antibody

TA346563

USD 475.00

5 Days

Rabbit Polyclonal Anti-Cpa2 Antibody

Applications	WB
Reactivities	Rat
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-Cpa2 antibody is: synthetic peptide directed towards the middle region of Rat Cpa2. Synthetic peptide located within the following region: GPGASSSPCSDSYHGPKPNSEVEVKSIVDFIKSHGKVKAFITLHSYSQLL

Carboxypeptidase A2 (CPA2) Rabbit Polyclonal Antibody

TA318966

USD 355.00

3 Weeks

Rabbit polyclonal anti-Carboxypeptidase A2 (CPA2) antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to residues surrounding amino acids 194 of mouse Carboxypeptidase A2

Carboxypeptidase A2 (CPA2) Mouse Monoclonal Antibody [Clone ID: OTI1C7]

CF504622

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) CPA2 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Carboxypeptidase A2 (CPA2) Mouse Monoclonal Antibody [Clone ID: OTI1A1]

CF504644

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) CPA2 mouse monoclonal antibody, clone OTI1A1 (formerly 1A1)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Carboxypeptidase A2 (CPA2) Mouse Monoclonal Antibody [Clone ID: OTI1D8]

CF504645

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) CPA2 mouse monoclonal antibody, clone OTI1D8 (formerly 1D8)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Carboxypeptidase A2 (CPA2) Mouse Monoclonal Antibody [Clone ID: OTI2E7]

CF504676

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CPA2 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Carboxypeptidase A2 (CPA2) Mouse Monoclonal Antibody [Clone ID: OTI7G2]

CF504695

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CPA2 mouse monoclonal antibody, clone OTI7G2 (formerly 7G2)

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

Carboxypeptidase A2 (CPA2) Mouse Monoclonal Antibody [Clone ID: OTI3D8]

CF504696

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CPA2 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Carboxypeptidase A2 (CPA2) Rabbit Polyclonal Antibody

TA349822

USD 345.00

In Stock

Rabbit Polyclonal Anti-CPA2 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human CPA2

CPA2 Rabbit Polyclonal Antibody

TA369049

USD 380.00

4 Weeks

CPA2 rabbit polyclonal antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human CPA2

Carboxypeptidase A2 (CPA2) Rabbit Polyclonal Antibody

TA375024

USD 220.00

3 Weeks

CPA2 Rabbit polyclonal Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 115-419 of human CPA2 (NP_001860.2).
Modifications	Unmodified

Carboxypeptidase A2 (CPA2) Mouse Monoclonal Antibody [Clone ID: OTI1C7]

TA504622

USD 379.00

In Stock

CPA2 (Carboxypeptidase A2) mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Carboxypeptidase A2 (CPA2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C7]

TA504622AM

USD 420.00

4 Weeks

CPA2 (Carboxypeptidase A2) mouse monoclonal antibody, clone OTI1C7 (formerly 1C7), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Carboxypeptidase A2 (CPA2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C7]

TA504622BM

USD 420.00

4 Weeks

CPA2 (Carboxypeptidase A2) mouse monoclonal antibody, clone OTI1C7 (formerly 1C7), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Carboxypeptidase A2 (CPA2) Mouse Monoclonal Antibody [Clone ID: OTI1C7]

TA504622S

USD 159.00

2 Days

CPA2 (Carboxypeptidase A2) mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Carboxypeptidase A2 (CPA2) Mouse Monoclonal Antibody [Clone ID: OTI1A1]

TA504644

USD 379.00

In Stock

CPA2 (Carboxypeptidase A2) mouse monoclonal antibody, clone OTI1A1 (formerly 1A1)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Carboxypeptidase A2 (CPA2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A1]

TA504644AM

USD 420.00

4 Weeks

CPA2 (Carboxypeptidase A2) mouse monoclonal antibody, clone OTI1A1 (formerly 1A1), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Carboxypeptidase A2 (CPA2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A1]

TA504644BM

USD 420.00

4 Weeks

CPA2 (Carboxypeptidase A2) mouse monoclonal antibody, clone OTI1A1 (formerly 1A1), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Carboxypeptidase A2 (CPA2) Mouse Monoclonal Antibody [Clone ID: OTI1A1]

TA504644S

USD 159.00

2 Days

CPA2 (Carboxypeptidase A2) mouse monoclonal antibody, clone OTI1A1 (formerly 1A1)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Carboxypeptidase A2 (CPA2) Mouse Monoclonal Antibody [Clone ID: OTI1D8]

TA504645

USD 379.00

In Stock

CPA2 (Carboxypeptidase A2) mouse monoclonal antibody, clone OTI1D8 (formerly 1D8)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Carboxypeptidase A2 (CPA2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D8]

TA504645AM

USD 420.00

4 Weeks

CPA2 (Carboxypeptidase A2) mouse monoclonal antibody, clone OTI1D8 (formerly 1D8), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Carboxypeptidase A2 (CPA2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D8]

TA504645BM

USD 420.00

4 Weeks

CPA2 (Carboxypeptidase A2) mouse monoclonal antibody, clone OTI1D8 (formerly 1D8), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Carboxypeptidase A2 (CPA2) Mouse Monoclonal Antibody [Clone ID: OTI1D8]

TA504645S

USD 159.00

2 Days

CPA2 (Carboxypeptidase A2) mouse monoclonal antibody, clone OTI1D8 (formerly 1D8)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Carboxypeptidase A2 (CPA2) Mouse Monoclonal Antibody [Clone ID: OTI2E7]

TA504676

USD 379.00

In Stock

CPA2 (Carboxypeptidase A2) mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Carboxypeptidase A2 (CPA2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E7]

TA504676AM

USD 420.00

5 Days

CPA2 mouse monoclonal antibody,clone 2E7, Biotinylated

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 2

2 / 2

Previous Next

Carboxypeptidase A2 (CPA2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E7]

TA504676BM

USD 420.00

5 Days

CPA2 mouse monoclonal antibody,clone 2E7, HRP conjugated

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 2

2 / 2

Previous Next

Carboxypeptidase A2 (CPA2) Mouse Monoclonal Antibody [Clone ID: OTI2E7]

TA504676S

USD 159.00

2 Days

CPA2 (Carboxypeptidase A2) mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Carboxypeptidase A2 (CPA2) Mouse Monoclonal Antibody [Clone ID: OTI7G2]

TA504695

USD 379.00

In Stock

CPA2 (Carboxypeptidase A2) mouse monoclonal antibody, clone OTI7G2 (formerly 7G2)

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

Carboxypeptidase A2 (CPA2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7G2]

TA504695AM

USD 420.00

5 Days

CPA2 mouse monoclonal antibody,clone 7G2, Biotinylated

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

Carboxypeptidase A2 (CPA2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7G2]

TA504695BM

USD 420.00

5 Days

CPA2 mouse monoclonal antibody,clone 7G2, HRP conjugated

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

Carboxypeptidase A2 (CPA2) Mouse Monoclonal Antibody [Clone ID: OTI7G2]

TA504695S

USD 159.00

2 Days

CPA2 (Carboxypeptidase A2) mouse monoclonal antibody, clone OTI7G2 (formerly 7G2)

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

Carboxypeptidase A2 (CPA2) Mouse Monoclonal Antibody [Clone ID: OTI3D8]

TA504696

USD 379.00

In Stock

CPA2 (Carboxypeptidase A2) mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Carboxypeptidase A2 (CPA2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D8]

TA504696AM

USD 420.00

5 Days

CPA2 mouse monoclonal antibody,clone 3D8, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Carboxypeptidase A2 (CPA2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D8]

TA504696BM

USD 420.00

5 Days

CPA2 mouse monoclonal antibody,clone 3D8, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Carboxypeptidase A2 (CPA2) Mouse Monoclonal Antibody [Clone ID: OTI3D8]

TA504696S

USD 159.00

2 Days

CPA2 (Carboxypeptidase A2) mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

1 - 35 of 35 results