Primary Antibodies

View as table Download

Rabbit polyclonal CSGALNACT1 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CSGALNACT1.

Rabbit Polyclonal Anti-CSGALNACT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSGALNACT1 antibody: synthetic peptide directed towards the N terminal of human CSGALNACT1. Synthetic peptide located within the following region: KAEVNAGVKLATEYAAVPFDSFTLQKVYQLETGLTRHPEEKPVRKDKRDE

Rabbit Polyclonal Anti-ChGn Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ChGn antibody: synthetic peptide directed towards the C terminal of human ChGn. Synthetic peptide located within the following region: DELTPEQYKMCMQSKAMNEASHGQLGMLVFRHEIEAHLRKQKQKTSSKKT

CSGALNACT1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human CGAT1

beta 4 GalNAcT1 Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human CSGALNACT1. AA range:201-250