Primary Antibodies

Jump to Filters
View as table Download
OR10J5 Rabbit Polyclonal Antibody
TA316084

USD 345.00

4 Weeks

Rabbit polyclonal anti-OR10J5 antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR10J5.
OR10J5 Rabbit Polyclonal Antibody
TA316085

USD 345.00

In Stock

Rabbit polyclonal anti-OR6B2 antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR6B2.
OR10J5 (C-term) Rabbit Polyclonal Antibody
AP53011PU-N

USD 450.00

2 Weeks

OR10J5 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 250-278 amino acids from the C-terminal region of human OR10J5
OR10J5 Rabbit Polyclonal Antibody
TA332321

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR10J5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR10J5 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR10J5. Synthetic peptide located within the following region: CIDTTINEIINYGVSSFVIFVPIGLIFISYVLVISSILQIASAEGRKKTF
OR10J5 Rabbit Polyclonal Antibody
TA340898

USD 425.00

5 Days

Rabbit Polyclonal Anti-OR10J5 Antibody (Extracellular Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen OR10J5 antibody was raised against synthetic 16 amino acid peptide from 2nd extracellular domain of human OR10J5. Percent identity with other species by BLAST analysis: Human, Gibbon, Elephant, Horse (100%); Gorilla, Hamster, Dog (94%); Mouse, Rat, Panda (88%); Bovine, Pig (81%).