Primary Antibodies

View as table Download

Rabbit polyclonal OR2AG1/2AG2 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR2AG1.

Rabbit Polyclonal Anti-OR2AG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR2AG1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR2AG1. Synthetic peptide located within the following region: LAAILASYTQILLTVLHMPSNEGRKKALVTCSSHLTVVGMFYGAATFMYV