Primary Antibodies

Jump to Filters
View as table Download
Band 3 (SLC4A1) Rabbit Monoclonal Antibody [Clone ID: OTIR5D8]
TA591014

USD 428.00

In Stock

Rabbit monoclonal anti-B3AT antibody for SISCAPA, clone OTIR5D8

Applications SISCAPA
Reactivities Human
Conjugation Unconjugated
Band 3 (SLC4A1) Rabbit Polyclonal Antibody
TA371272

USD 380.00

4 Weeks

SLC4A1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC4A1
Band 3 (SLC4A1) Rabbit Polyclonal Antibody
TA317931

USD 425.00

In Stock

Band 3 / AE1 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen SLC4A1 / Band 3 / AE1 antibody was raised against synthetic peptide from human SLC4A1 / Band 3.
Band 3 (SLC4A1) Rabbit Polyclonal Antibody
TA334275

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC4A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC4A1 antibody: synthetic peptide directed towards the N terminal of human SLC4A1. Synthetic peptide located within the following region: PSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGR
Band 3 (SLC4A1) Mouse Monoclonal Antibody [Clone ID: Q1/156]
TA352929L

USD 1,140.00

2 Weeks

Mouse monoclonal Anti-Band III Clone Q1/156

Reactivities Human
Conjugation Unconjugated
Band 3 (SLC4A1) Rabbit Polyclonal Antibody
TA351002

USD 345.00

In Stock

Rabbit Polyclonal Anti-SLC4A1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC4A1
Band 3 (SLC4A1) Rabbit Polyclonal Antibody
TA381670

USD 220.00

3 Weeks

SLC4A1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-353 of human SLC4A1 (NP_000333.1).