Rabbit Polyclonal 12-Lipoxygenase Antibody
Applications | ELISA, IF, IHC |
Reactivities | Human |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal 12-Lipoxygenase Antibody
Applications | ELISA, IF, IHC |
Reactivities | Human |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit polyclonal ALOX12 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ALOX12 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 618-650 amino acids from the C-terminal region of human ALOX12. |
Rabbit Polyclonal Anti-ALOX12 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ALOX12 Antibody: synthetic peptide directed towards the C terminal of human ALOX12. Synthetic peptide located within the following region: MGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQF |
Carrier-free (BSA/glycerol-free) ALOX12 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALOX12 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALOX12 mouse monoclonal antibody, clone OTI5H2 (formerly 5H2)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
ALOX12 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ALOX12 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
USD 420.00
4 Weeks
ALOX12 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | HRP |
ALOX12 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
ALOX12 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ALOX12 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2), Biotinylated
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Biotin |
USD 420.00
4 Weeks
ALOX12 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2), HRP conjugated
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | HRP |
ALOX12 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
ALOX12 mouse monoclonal antibody, clone OTI5H2 (formerly 5H2)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ALOX12 mouse monoclonal antibody, clone OTI5H2 (formerly 5H2), Biotinylated
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
USD 420.00
4 Weeks
ALOX12 mouse monoclonal antibody, clone OTI5H2 (formerly 5H2), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | HRP |
ALOX12 mouse monoclonal antibody, clone OTI5H2 (formerly 5H2)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |