Primary Antibodies

View as table Download

Rabbit monoclonal anti-ANK1 antibody for SISCAPA, clone OTIR3A12

Applications SISCAPA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-ANK1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANK1 antibody: synthetic peptide directed towards the C terminal of human ANK1. Synthetic peptide located within the following region: VVRQIDLSSADAAQEHEEVELRGSGLQPDLIEGRKGAQIVKRASLKRGKQ

Rabbit Polyclonal Anti-ANK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANK1 antibody: synthetic peptide directed towards the middle region of human ANK1. Synthetic peptide located within the following region: PCAMPETVVIRSEEQEQASKEYDEDSLIPSSPATETSDNISPVASPVHTG