Primary Antibodies

View as table Download

Rabbit polyclonal anti-B4GALT5 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human B4GALT5.

Rabbit Polyclonal Anti-B4galt5 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-B4galt5 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKERQGLDGLNNLN

B4GALT5 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human B4GALT5

B4GALT5 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human B4GALT5

B4GALT5 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human B4GALT5

B4GALT5 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 60-160 of human B4GALT5 (NP_004767.1).
Modifications Unmodified

B4GALT5 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human B4GALT5. AA range:321-370