Rabbit polyclonal anti-B4GALT5 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human B4GALT5. |
Rabbit polyclonal anti-B4GALT5 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human B4GALT5. |
Rabbit Polyclonal Anti-B4galt5 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-B4galt5 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKERQGLDGLNNLN |
B4GALT5 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human B4GALT5 |
B4GALT5 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human B4GALT5 |
B4GALT5 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human B4GALT5 |
B4GALT5 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 60-160 of human B4GALT5 (NP_004767.1). |
Modifications | Unmodified |
B4GALT5 Rabbit polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human B4GALT5. AA range:321-370 |