Primary Antibodies

View as table Download

Chicken Polyclonal CCDC69 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CCDC69 antibody was raised against a 16 amino acid peptide near the amino terminus of human CCDC69.

Rabbit Polyclonal Anti-CCDC69 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CCDC69 Antibody: synthetic peptide directed towards the middle region of human CCDC69. Synthetic peptide located within the following region: TREALEKEVQLRRQLQQEKEELLYRVLGANASPAFPLAPVTPTEVSFLAT