Carboxylesterase 7 (CES5A) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human CES7 |
Carboxylesterase 7 (CES5A) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human CES7 |
Rabbit Polyclonal Anti-CES5A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CES7 antibody: synthetic peptide directed towards the N terminal of human CES7. Synthetic peptide located within the following region: SGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSP |
Rabbit Polyclonal Anti-CES5A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CES7 antibody: synthetic peptide directed towards the middle region of human CES7. Synthetic peptide located within the following region: LTEIRDSLLDLLGDVFFVVPALITARYHREGATEEEKLLSRKMMKYWATF |