Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CLDN17 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN17 antibody: synthetic peptide directed towards the middle region of human CLDN17. Synthetic peptide located within the following region: KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA

CLDN17 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human CLDN17 (NP_036263.1).
Modifications Unmodified