Rabbit Polyclonal Anti-DDX23 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX23 antibody: synthetic peptide directed towards the C terminal of human DDX23. Synthetic peptide located within the following region: EDSAVFYELKQAILESPVSSCPPELANHPDAQHKPGTILTKKRREETIFA |
DDX23 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
DDX23 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DDX23 |
Germany
Japan
United Kingdom
China
