Primary Antibodies

View as table Download

Rabbit polyclonal anti-EPN3 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EPN3.

EPN3 (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human EPN3

Rabbit Polyclonal Anti-EPN3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-EPN3 Antibody is: synthetic peptide directed towards the C-terminal region of Human EPN3. Synthetic peptide located within the following region: ESTETKEGLEQALPSGKPSSPVELDLFGDPSPSSKQNGTKEPDALDLGIL

EPN3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human EPN3