Goat Polyclonal Antibody against FBXW2
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KRGSSFLAGEHPG, from the C Terminus of the protein sequence according to NP_036296.1. |
Goat Polyclonal Antibody against FBXW2
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KRGSSFLAGEHPG, from the C Terminus of the protein sequence according to NP_036296.1. |
Rabbit Polyclonal Anti-FBXW2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FBXW2 antibody: synthetic peptide directed towards the middle region of human FBXW2. Synthetic peptide located within the following region: SLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSI |