Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-HAO2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HAO2 antibody: synthetic peptide directed towards the N terminal of human HAO2. Synthetic peptide located within the following region: DDNIAAFKRIRLRPRYLRDVSEVDTRTTIQGEEISAPICIAPTGFHCLVW

Hao2 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated

HAO2 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-351 of human HAO2 (NP_057611.1).
Modifications Unmodified