Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-KTN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KTN1 Antibody: synthetic peptide directed towards the middle region of human KTN1. Synthetic peptide located within the following region: EELLKVISEREKEISGLWNELDSLKDAVEHQRKKNNDLREKNWEAMEALA

KTN1 Antibody - middle region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human KTN1

KTN1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KTN1 (NP_001072989.1).
Modifications Unmodified

KTN1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 25-125 of human KTN1 (NP_001072989.1).
Modifications Unmodified

KTN1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KTN1 (NP_001072989.1).
Modifications Unmodified