Primary Antibodies

View as table Download

MCCC2 (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the Center region of human MCCC2.

Rabbit Polyclonal Anti-MCCC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MCCC2 antibody is: synthetic peptide directed towards the C-terminal region of Human MCCC2. Synthetic peptide located within the following region: RKVVRNLNYQKKLDVTIEPSEEPLFPADELYGIVGANLKRSFDVREVIAR

Rabbit Polyclonal Anti-MCCC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MCCC2 antibody is: synthetic peptide directed towards the N-terminal region of Human MCCC2. Synthetic peptide located within the following region: LPRERIDNLIDPGSPFLELSQFAGYQLYDNEEVPGGGIITGIGRVSGVEC

MCCC2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human MCCC2

MCCC2 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 284-563 of human MCCC2 (NP_071415.1).
Modifications Unmodified

MCCC2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 284-563 of human MCCC2 (NP_071415.1).
Modifications Unmodified