Rabbit polyclonal anti-OR10G2 antibody
Applications | IF, WB |
Reactivities | Human |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR10G2. |
Rabbit polyclonal anti-OR10G2 antibody
Applications | IF, WB |
Reactivities | Human |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR10G2. |
OR10G2 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 75-103 amino acids from the N-terminal region of Human Olfactory receptor 10G2 |
Rabbit Polyclonal Anti-OR10G2 Antibody
Applications | WB |
Reactivities | Human |
Immunogen | The immunogen for Anti-OR10G2 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR10G2. Synthetic peptide located within the following region: PCIFIYLRAGSKDPLDGAAAVFYTVVTPLLNPLIYTLRNQEVKSALKRIT |