OR2W3 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 293-314 amino acids from the C-terminal region of human Olfactory receptor 2W3 |
OR2W3 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 293-314 amino acids from the C-terminal region of human Olfactory receptor 2W3 |
Rabbit polyclonal anti-OR2W3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR2W3. |
Rabbit Polyclonal Anti-OR2W3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-OR2W3 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2W3. Synthetic peptide located within the following region: IIYMYMQPGASSSQDQGMFLMLFYNIVTPLLNPLIYTLRNREVKGALGRL |