Rabbit polyclonal anti-OR51A2 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR51A2. |
Rabbit polyclonal anti-OR51A2 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR51A2. |
Rabbit Polyclonal Anti-OR51A2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-OR51A2 Antibody is: synthetic peptide directed towards the N-terminal region of Human OR51A2. Synthetic peptide located within the following region: LSMLAMSDLGLSLSSLPTVLSIFLFNAPETSSSACFAQEFFIHGFSVLES |