Rabbit polyclonal anti-OR52D1 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR52D1. |
Rabbit polyclonal anti-OR52D1 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR52D1. |
OR52D1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 251-281 amino acids from the C-terminal region of human Olfactory receptor 52D1 |
Rabbit Polyclonal Anti-OR52D1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-OR52D1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR52D1. Synthetic peptide located within the following region: ALLAMGLDSILIAISYGFILHAVFHLPSHDAQHKALSTCGSHIGIILVFY |