Rabbit polyclonal anti-OR6C70 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR6C70. |
Rabbit polyclonal anti-OR6C70 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR6C70. |
Rabbit Polyclonal Anti-OR6C70 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-OR6C70 Antibody: synthetic peptide directed towards the C terminal of human OR6C70. Synthetic peptide located within the following region: GSCMFIYIKPSANERVALSKGVTVLNTSVAPLLNPFIYTLRNQQVKQAFK |