PC1/3 (PCSK1) (652-754) mouse monoclonal antibody, clone 3D2, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
PC1/3 (PCSK1) (652-754) mouse monoclonal antibody, clone 3D2, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal Anti-PCSK1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PCSK1 antibody: synthetic peptide directed towards the middle region of human PCSK1. Synthetic peptide located within the following region: QSPKKSPSAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTK |