Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-PIGZ Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIGZ antibody: synthetic peptide directed towards the N terminal of human PIGZ. Synthetic peptide located within the following region: VLWGGLSLLRVLWCLLPQTGYVHPDEFFQSPEVMAEDILGVQAARPWEFY

PIGZ Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 435-579 of human PIGZ (NP_079439.2).
Modifications Unmodified