Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-PLXNA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLXNA2 antibody: synthetic peptide directed towards the N terminal of human PLXNA2. Synthetic peptide located within the following region: SVASYVYNGYSVVFVGTKSGKLKKIRADGPPHGGVQYEMVSVLKDGSPIL

Rabbit Polyclonal Anti-PLXNA2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PLXNA2

PLXNA2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PLXNA2

PLXNA2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 300-560 of human PLXNA2 (NP_079455.3).
Modifications Unmodified