Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-POLR3A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR3A antibody: synthetic peptide directed towards the middle region of human POLR3A. Synthetic peptide located within the following region: AYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADRDPNPPKRPLIFDT

Rabbit polyclonal antibody to POLR3A (polymerase (RNA) III (DNA directed) polypeptide A, 155kDa)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 182 and 482 of POLR3A (Uniprot ID#O14802)

POLR3A rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit polyclonal anti-RPC1 / POLR3A antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPC1.

POLR3A Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human POLR3A (NP_008986.2).
Modifications Unmodified