Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-PPIL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPIL1 antibody is: synthetic peptide directed towards the N-terminal region of Human PPIL1. Synthetic peptide located within the following region: YWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASI |
Carrier-free (BSA/glycerol-free) PPIL1 mouse monoclonal antibody, clone OTI2F1 (formerly 2F1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPIL1 mouse monoclonal antibody, clone OTI4C2 (formerly 4C2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPIL1 mouse monoclonal antibody, clone OTI8F8 (formerly 8F8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPIL1 mouse monoclonal antibody, clone OTI6H2 (formerly 6H2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PPIL1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-166 of human PPIL1 (NP_057143.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
Purified PPIL1 mouse monoclonal antibody, clone OTI2F1 (formerly 2F1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
Purified PPIL1 mouse monoclonal antibody, clone OTI2F1 (formerly 2F1), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
Purified PPIL1 mouse monoclonal antibody, clone OTI2F1 (formerly 2F1), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
Purified PPIL1 mouse monoclonal antibody, clone OTI2F1 (formerly 2F1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Purified PPIL1 mouse monoclonal antibody, clone OTI4C2 (formerly 4C2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
Purified PPIL1 mouse monoclonal antibody, clone OTI4C2 (formerly 4C2), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
Purified PPIL1 mouse monoclonal antibody, clone OTI4C2 (formerly 4C2), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
Purified PPIL1 mouse monoclonal antibody, clone OTI4C2 (formerly 4C2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Purified PPIL1 mouse monoclonal antibody, clone OTI8F8 (formerly 8F8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
Purified PPIL1 mouse monoclonal antibody, clone OTI8F8 (formerly 8F8), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
Purified PPIL1 mouse monoclonal antibody, clone OTI8F8 (formerly 8F8), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
Purified PPIL1 mouse monoclonal antibody, clone OTI8F8 (formerly 8F8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Purified PPIL1 mouse monoclonal antibody, clone OTI6H2 (formerly 6H2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
Purified PPIL1 mouse monoclonal antibody, clone OTI6H2 (formerly 6H2), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
Purified PPIL1 mouse monoclonal antibody, clone OTI6H2 (formerly 6H2), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
Purified PPIL1 mouse monoclonal antibody, clone OTI6H2 (formerly 6H2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- PPIL1