Primary Antibodies

View as table Download

Rabbit polyclonal anti-PPM1L antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PPM1L.

PPM1L (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 215-244 amino acids from the C-terminal region of Human PPM1L

Rabbit Polyclonal Anti-PPM1L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PPM1L Antibody is: synthetic peptide directed towards the middle region of Human PPM1L. Synthetic peptide located within the following region: SRLPEALKQHLQDYEKDKENSVLSYQTILEQQILSIDREMLEKLTVSYDE