Rabbit polyclonal anti-PP4R2 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PP4R2. |
Rabbit polyclonal anti-PP4R2 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PP4R2. |
Rabbit Polyclonal anti-PPP4R2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP4R2 antibody: synthetic peptide directed towards the C terminal of human PPP4R2. Synthetic peptide located within the following region: DSRCTRQHCTEEDEEEDEEEEEESFMTSREMIPERKNQEKESDDALTVNE |