Primary Antibodies

View as table Download

Rabbit anti-PSME2 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human PSME2

Goat Polyclonal Antibody against PSME2

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-NLEKIVNPKGEEKP, from the C Terminus of the protein sequence according to NP_002809.2.

PSME2 (C-term) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human PSME2

PSME2 (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the Center region of human PSME2

Rabbit polyclonal Anti-PSME2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSME2 antibody: synthetic peptide directed towards the middle region of human PSME2. Synthetic peptide located within the following region: QEKVLERVNAVKTKVEAFQTTISKYFSERGDAVAKASKETHVMDYRALVH

Rabbit polyclonal Anti-PSME2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSME2 antibody: synthetic peptide directed towards the middle region of human PSME2. Synthetic peptide located within the following region: SKETHVMDYRALVHERDEAAYGELRAMVLDLRAFYAELYHIISSNLEKIV

PSME2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-239 of human PSME2 (NP_002809.2).
Modifications Unmodified