Primary Antibodies

View as table Download

Rab6b rat monoclonal antibody, clone KT79, Aff - Purified

Applications IF, WB
Reactivities Mouse

Rab6b rat monoclonal antibody, clone KT79, Aff - Purified

Applications IF, WB
Reactivities Mouse

Rab6b rat monoclonal antibody, clone KT79, Aff - Purified

Applications IF, WB
Reactivities Mouse

Rabbit Polyclonal Anti-Rab6b Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Rab6b antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rab6b. Synthetic peptide located within the following region: KTGYNVKQLFRRVASALPGMENVQEKSKEGMIDIKLDKPQEPPASEGGCS

RAB6B Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAB6B

RAB6B Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human RAB6B