Rabbit Polyclonal Anti-C15orf15 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C15orf15 antibody: synthetic peptide directed towards the middle region of human C15orf15. Synthetic peptide located within the following region: FIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQED |
Rabbit Polyclonal Anti-C15orf15 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C15orf15 antibody: synthetic peptide directed towards the middle region of human C15orf15. Synthetic peptide located within the following region: KCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIKYQRE |
RSL24D1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human RLP24 |
RSL24D1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 10-80 of human RSL24D1 (NP_057388.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China