Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-SLC2A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC2A2 antibody: synthetic peptide directed towards the N terminal of human SLC2A2. Synthetic peptide located within the following region: ITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYVINST

Rabbit Polyclonal Glut2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human GLUT2 protein (between residues 50-150) [UniProt P11168]

GLUT2 Goat Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Conjugation Unconjugated
Immunogen SLC2A2 / GLUT2 antibody was raised against synthetic peptide C-RKEREEASSEQKVS from an internal region of human SLC2A2 / GLUT2 (NP_000331.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset, Panda, Bat, Rabbit, Horse, Pig (93%); Rat, Sheep, Elephant, Dog, Bovine (86%).

Rabbit Polyclonal Anti-SLC2A2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC2A2

GLUT2/SLC2A2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GLUT2/GLUT2/SLC2A2 (NP_000331.1).
Modifications Unmodified