Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Goat Anti-SLC2A4 / GLUT4 Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TELEYLGPDEND, from the C Terminus of the protein sequence according to NP_001033.1. |
Rabbit Polyclonal Anti-SLC2A4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC2A4 Antibody: synthetic peptide directed towards the N terminal of human SLC2A4. Synthetic peptide located within the following region: LQFGYNIGVINAPQKVIEQSYNETWLGRQGPEGPSSIPPGTLTTLWALSV |
Anti-SLC2A4 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 496-509 amino acids of human solute carrier family 2 (facilitated glucose transporter), member 4 |
Anti-SLC2A4 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 496-509 amino acids of human solute carrier family 2 (facilitated glucose transporter), member 4 |
SLC2A4 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SLC2A4 |
GLUT4 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human GLUT4 (NP_001033.1). |
| Modifications | Unmodified |
Glucose Transporter GLUT4 Rabbit polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from the N-terminal region of human SLC2A4. AA range:21-70 |
Active filters
Target Symbol
- SLC2A4