Rabbit Polyclonal Anti-ST3GAL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ST3GAL3 antibody: synthetic peptide directed towards the C terminal of human ST3GAL3. Synthetic peptide located within the following region: GFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITD |
Rabbit Polyclonal Anti-ST3GAL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ST3GAL3 antibody: synthetic peptide directed towards the N terminal of human ST3GAL3. Synthetic peptide located within the following region: MTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTK |
ST3GAL3 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-375 of human ST3GAL3 (NP_006270.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China