Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-SR140 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SR140 antibody: synthetic peptide directed towards the N terminal of human SR140. Synthetic peptide located within the following region: NLSRPLLENKLKAFSIGKMSTAKRTLSKKEQEELKKKEDEKAAAEIYEEF

Rabbit Polyclonal Anti-SR140 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SR140 antibody: synthetic peptide directed towards the middle region of human SR140. Synthetic peptide located within the following region: KVAPSKWEAVDESELEAQAVTTSKWELFDQHEESEEEENQNQEEESEDEE

U2SURP Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human SR140

U2SURP Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 705-1029 of human U2SURP (NP_001073884.1).
Modifications Unmodified