Primary Antibodies

View as table Download

Rabbit Polyclonal VENTX Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen VENTX antibody was raised against a 16 amino acid synthetic peptide near the center of human VENTX.

Rabbit polyclonal anti-VENTX antibody

Applications WB
Reactivities Human, Mouse, Rat, Xenopus
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 76 of human VENTX

Rabbit Polyclonal Anti-VENTX Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VENTX antibody: synthetic peptide directed towards the middle region of human VENTX. Synthetic peptide located within the following region: VAQEALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCAMPQTGDA

Rabbit Polyclonal Anti-VENTX Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VENTX antibody: synthetic peptide directed towards the middle region of human VENTX. Synthetic peptide located within the following region: NLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLE

VENTX rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Full length fusion protein

VENTX Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-258 of human VENTX (NP_055283.1).
Modifications Unmodified