Dopamine beta Hydroxylase (DBH) rabbit polyclonal antibody
Applications | IF, IHC, WB |
Reactivities | Bovine, Equine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Dopamine beta Hydroxylase (DBH) rabbit polyclonal antibody
Applications | IF, IHC, WB |
Reactivities | Bovine, Equine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal MUC-1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |