Rabbit polyclonal GTF2I Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GTF2I antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 956-985 amino acids from the C-terminal region of human GTF2I. |
Rabbit Polyclonal Anti-GTF2B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2B antibody: synthetic peptide directed towards the N terminal of human GTF2B. Synthetic peptide located within the following region: NLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFK |
Rabbit Polyclonal Anti-TAF11 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TAF11 |
Germany
Japan
United Kingdom
China
