Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 18 of 18 results

(reset)

CBS Rabbit Polyclonal Antibody

TA308071

USD 415.00

In Stock

Rabbit Polyclonal antibody to CBS (cystathionine-beta-synthase)

Applications	IF, IHC, IP, WB
Reactivities	Human
Immunogen	Recombinant fragment corresponding to a region within amino acids 39 and 251 of CBS (Uniprot ID#P35520)

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

CBS Rabbit Polyclonal Antibody

TA338394

USD 310.00

5 Days

Rabbit Polyclonal Anti-CBS Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

MAT1A Rabbit Polyclonal Antibody

TA346036

USD 410.00

5 Days

Rabbit Polyclonal Anti-MAT1A Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-MAT1A antibody: synthetic peptide directed towards the N terminal of human MAT1A. Synthetic peptide located within the following region: TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE

1 / 2

2 / 2

Previous Next

BUD23 Rabbit Polyclonal Antibody

TA308485

USD 415.00

In Stock

Rabbit Polyclonal antibody to WBSCR22 (Williams Beuren syndrome chromosome region 22)

Applications	IHC, IP, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 263 of WBSCR22 (Uniprot ID#O43709)

1 / 3

2 / 3

3 / 3

Previous Next

GGT1 Rabbit Polyclonal Antibody

TA327174

USD 275.00

3 Weeks

GGT1 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human GGT1

LCMT1 Rabbit Polyclonal Antibody

TA350130

USD 345.00

In Stock

Rabbit Polyclonal Anti-LCMT1 Antibody

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human LCMT1

1 / 3

2 / 3

3 / 3

Previous Next

S adenosylhomocysteine hydrolase (AHCY) (N-term) Rabbit Polyclonal Antibody

AP50117PU-N

USD 450.00

2 Weeks

S adenosylhomocysteine hydrolase (AHCY) (N-term) rabbit polyclonal antibody, Purified

Applications	FC, IHC, WB
Reactivities	Human, Mouse
Immunogen	KLH conjugated synthetic peptide between 86-118 amino acids from the N-terminal region of human AHCY

1 / 3

2 / 3

3 / 3

Previous Next

HEMK1 (C-term) Rabbit Polyclonal Antibody

AP52029PU-N

USD 450.00

2 Weeks

HEMK1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications	FC, IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 311-338 amino acids from the C-terminal region of human HEMK1

1 / 2

2 / 2

Previous Next

Selenophosphate synthetase 1 (SEPHS1) Rabbit Polyclonal Antibody

TA308432

USD 415.00

5 Days

Rabbit polyclonal antibody to Selenophosphate synthetase 1 (selenophosphate synthetase 1)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 204 of Selenophosphate synthetase 1 (Uniprot ID#P49903)

1 / 3

2 / 3

3 / 3

Previous Next

AHCYL2 Rabbit Polyclonal Antibody

TA308718

USD 415.00

5 Days

Rabbit Polyclonal antibody to AHCYL2 (adenosylhomocysteinase-like 2)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 298 and 578 of AHCYL2 (Uniprot ID#Q96HN2)

1 / 3

2 / 3

3 / 3

Previous Next

LCMT2 Rabbit Polyclonal Antibody

TA319792

USD 430.00

5 Days

Rabbit Polyclonal TYW4 Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	TYW4 antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human TYW4.

1 / 3

2 / 3

3 / 3

Previous Next

Cystathionase (CTH) Rabbit Polyclonal Antibody

TA339248

USD 310.00

5 Days

Rabbit Polyclonal Anti-CTH Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-CTH antibody: synthetic peptide directed towards the C terminal of human CTH. Synthetic peptide located within the following region: ESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLK

1 / 2

2 / 2

Previous Next

MAT1A (N-term) Rabbit Polyclonal Antibody

AP52613PU-N

USD 450.00

2 Weeks

MAT1A (N-term) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 114-144 amino acids from the N-terminal region of human MAT1A

1 / 2

2 / 2

Previous Next

MAT2B (N-term) Rabbit Polyclonal Antibody

AP52614PU-N

USD 450.00

2 Weeks

MAT2B (N-term) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 86~116 amino acids from the N-terminal region of human MAT2B

1 / 2

2 / 2

Previous Next

GGT1 Rabbit Polyclonal Antibody

TA308190

USD 415.00

5 Days

Rabbit Polyclonal antibody to GGT1 (gamma-glutamyltransferase 1)

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 226 of GGT1 (Uniprot ID#P19440)

1 / 3

2 / 3

3 / 3

Previous Next

PAPSS1 Rabbit Polyclonal Antibody

TA349567

USD 345.00

In Stock

Rabbit Polyclonal Anti-PAPSS1 Antibody

Applications	IHC
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Fusion protein of human PAPSS1

CBS Rabbit Polyclonal Antibody

TA349577

USD 345.00

In Stock

Rabbit Polyclonal Anti-CBS Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human CBS

1 / 3

2 / 3

3 / 3

Previous Next

GGT1 Rabbit Polyclonal Antibody

TA350015

USD 345.00

In Stock

Rabbit Polyclonal Anti-GGT1 Antibody

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human GGT1

1 - 18 of 18 results